Loading...
Statistics
Advertisement

Daylight Technology - Home
www.daylighttechusa.com/
LED Lighting Solutions is your one stop shop for commercial, hotel, school, retail and museum lighting LED retrofit lamps and fixtures.

Daylighttechusa.com

Advertisement
Conversion Technology Metas Server
Daylighttechusa.com is hosted in United States / Scottsdale . Daylighttechusa.com doesn't use HTTPS protocol. Number of used technologies: 3. First technologies: CSS, Html, Javascript, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: Microsoft-IIS/7.0.

Technologies in use by Daylighttechusa.com

Technology

Number of occurences: 3
  • CSS
  • Html
  • Javascript

Advertisement

Server Type

  • Microsoft-IIS/7.0

Powered by

  • ASP.NET

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Daylighttechusa.com

Missing HTTPS protocol.

    Meta - Daylighttechusa.com

    Number of occurences: 4
    • Name: keywords
      Content: SANSI, SANSITECH, LED, Shoe box, Garage Lighting, Fuel Pump Canopy Light, Flood Light, Nichia, BRAVO, T8, tube light, parking garage, parking lot, high bay, low bay, auto dealer, campus, MR16, most efficient light, lighting rebates, energy efficient, green technology, lighting manufacturer's representative, wholesale LED fixtures, Sansi Canopy Light LED, Toshiba LED lamps, LED T5, LED T8, LED fixtures for hotels, 2x2, 2x4, retrofit, retrofits, wholesale LED Indirect fixtures, free lighting upgrade, highest lumens per watt, made in USA solar panels, prefer solar, 240-255 Watt PV Solar Panels
    • Name: description
      Content: LED Lighting Solutions is your one stop shop for commercial, hotel, school, retail and museum lighting LED retrofit lamps and fixtures.
    • Name: robots
      Content: all
    • Name:
      Content: text/css

    Server / Hosting

    • IP: 184.168.27.204
    • Latitude: 33.61
    • Longitude: -111.89
    • Country: United States
    • City: Scottsdale

    Rname

    • ns27.domaincontrol.com
    • ns28.domaincontrol.com
    • mailstore1.secureserver.net
    • smtp.secureserver.net

    Target

    • dns.jomax.net

    HTTP Header Response

    HTTP/1.1 200 OK Content-Length: 13156 Content-Type: text/html Last-Modified: Thu, 08 May 2014 22:43:33 GMT Accept-Ranges: bytes ETag: "6685af1e6bcf1:0" Server: Microsoft-IIS/7.0 X-Powered-By: ASP.NET Date: Thu, 09 Jun 2016 19:03:38 GMT X-Cache: MISS from s_bd39 X-Cache-Lookup: MISS from s_bd39:80 Via: 1.1 s_bd39 (squid/3.5.19) Connection: keep-alive

    DNS

    host: daylighttechusa.com
    1. class: IN
    2. ttl: 600
    3. type: A
    4. ip: 184.168.27.204
    host: daylighttechusa.com
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: ns27.domaincontrol.com
    host: daylighttechusa.com
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: ns28.domaincontrol.com
    host: daylighttechusa.com
    1. class: IN
    2. ttl: 3600
    3. type: SOA
    4. mname: ns27.domaincontrol.com
    5. rname: dns.jomax.net
    6. serial: 2016050300
    7. refresh: 28800
    8. retry: 7200
    9. expire: 604800
    10. minimum-ttl: 3600
    host: daylighttechusa.com
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 10
    5. target: mailstore1.secureserver.net
    host: daylighttechusa.com
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 0
    5. target: smtp.secureserver.net

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.aylighttechusa.com, www.dtaylighttechusa.com, www.taylighttechusa.com, www.dbaylighttechusa.com, www.baylighttechusa.com, www.dxaylighttechusa.com, www.xaylighttechusa.com, www.dsaylighttechusa.com, www.saylighttechusa.com, www.dfaylighttechusa.com, www.faylighttechusa.com, www.dvaylighttechusa.com, www.vaylighttechusa.com, www.dyaylighttechusa.com, www.yaylighttechusa.com, www.dzaylighttechusa.com, www.zaylighttechusa.com, www.daaylighttechusa.com, www.aaylighttechusa.com, www.deaylighttechusa.com, www.eaylighttechusa.com, www.draylighttechusa.com, www.raylighttechusa.com, www.dylighttechusa.com, www.daoylighttechusa.com, www.doylighttechusa.com, www.dapylighttechusa.com, www.dpylighttechusa.com, www.da9ylighttechusa.com, www.d9ylighttechusa.com, www.daylighttechusa.com, www.dylighttechusa.com, www.daiylighttechusa.com, www.diylighttechusa.com, www.dauylighttechusa.com, www.duylighttechusa.com, www.dalighttechusa.com, www.dayzlighttechusa.com, www.dazlighttechusa.com, www.dayalighttechusa.com, www.daalighttechusa.com, www.dayslighttechusa.com, www.daslighttechusa.com, www.daydlighttechusa.com, www.dadlighttechusa.com, www.daylighttechusa.com, www.dalighttechusa.com, www.dayclighttechusa.com, www.daclighttechusa.com, www.day lighttechusa.com, www.da lighttechusa.com, www.dayighttechusa.com, www.dayluighttechusa.com, www.dayuighttechusa.com, www.dayl8ighttechusa.com, www.day8ighttechusa.com, www.dayl9ighttechusa.com, www.day9ighttechusa.com, www.dayljighttechusa.com, www.dayjighttechusa.com, www.dayl0ighttechusa.com, www.day0ighttechusa.com, www.daylmighttechusa.com, www.daymighttechusa.com, www.daylpighttechusa.com, www.daypighttechusa.com, www.dayloighttechusa.com, www.dayoighttechusa.com, www.daylghttechusa.com, www.daylirghttechusa.com, www.daylrghttechusa.com, www.daylifghttechusa.com, www.daylfghttechusa.com, www.daylivghttechusa.com, www.daylvghttechusa.com, www.daylikghttechusa.com, www.daylkghttechusa.com, www.dayli,ghttechusa.com, www.dayl,ghttechusa.com, www.daylibghttechusa.com, www.daylbghttechusa.com, www.dayligghttechusa.com, www.daylgghttechusa.com, www.daylitghttechusa.com, www.dayltghttechusa.com, www.dayliyghttechusa.com, www.daylyghttechusa.com, www.dayliughttechusa.com, www.daylughttechusa.com, www.daylijghttechusa.com, www.dayljghttechusa.com, www.daylimghttechusa.com, www.daylmghttechusa.com, www.daylinghttechusa.com, www.daylnghttechusa.com, www.daylihttechusa.com, www.dayligshttechusa.com, www.daylishttechusa.com, www.dayligxhttechusa.com, www.daylixhttechusa.com, www.dayligyhttechusa.com, www.dayliyhttechusa.com, www.daylighhttechusa.com, www.daylihhttechusa.com, www.daylignhttechusa.com, www.daylinhttechusa.com, www.dayligchttechusa.com, www.daylichttechusa.com, www.dayligdhttechusa.com, www.daylidhttechusa.com, www.dayligehttechusa.com, www.dayliehttechusa.com, www.dayligrhttechusa.com, www.daylirhttechusa.com, www.dayligthttechusa.com, www.daylithttechusa.com, www.dayligbhttechusa.com, www.daylibhttechusa.com, www.dayligvhttechusa.com, www.daylivhttechusa.com, www.dayligttechusa.com, www.daylighettechusa.com, www.dayligettechusa.com, www.daylighdttechusa.com, www.dayligdttechusa.com, www.daylighcttechusa.com, www.dayligcttechusa.com, www.daylighuttechusa.com, www.dayliguttechusa.com, www.daylighjttechusa.com, www.dayligjttechusa.com, www.daylighttechusa.com, www.dayligttechusa.com, www.daylighbttechusa.com, www.dayligbttechusa.com, www.daylighgttechusa.com, www.dayliggttechusa.com, www.daylightechusa.com, www.daylightqtechusa.com, www.daylighqtechusa.com, www.daylightatechusa.com, www.daylighatechusa.com, www.daylight techusa.com, www.dayligh techusa.com, www.daylightwtechusa.com, www.daylighwtechusa.com, www.daylightetechusa.com, www.daylighetechusa.com, www.daylightztechusa.com, www.daylighztechusa.com, www.daylightxtechusa.com, www.daylighxtechusa.com, www.daylightctechusa.com, www.daylighctechusa.com, www.daylightechusa.com, www.daylighttqechusa.com, www.daylightqechusa.com, www.daylighttaechusa.com, www.daylightaechusa.com, www.daylightt echusa.com, www.daylight echusa.com, www.daylighttwechusa.com, www.daylightwechusa.com, www.daylightteechusa.com, www.daylighteechusa.com, www.daylighttzechusa.com, www.daylightzechusa.com, www.daylighttxechusa.com, www.daylightxechusa.com, www.daylighttcechusa.com, www.daylightcechusa.com,

    Other websites we recently analyzed

    1. Amiliő | lakberendezés, ékszer, ajándék | Miskolc
      Üzletünk lakberendezési cikkek, ékszerek és ajándéktárgyak széles választékával várja Önt, Miskolc belvárosában.
      Dány (Hungary) - 81.0.75.81
      Server software: Apache/2.2.25 (Unix) mod_ssl/2.2.25 OpenSSL/0.9.8e-fips-rhel5 mod_bwlimited/1.4 mod_fcgid/2.3.6
      Technology: CSS, Html, Javascript, Php, Google Analytics
      Number of Javascript: 2
      Number of meta tags: 4
    2. Homely Hood Style – Heavenly Touch
      Provo (United States) - 50.87.145.8
      Server software: nginx/1.10.0
      Technology: Maxcdn, OSS CDN, AJAX Libraries API, Carousel, CSS, Google Font API, Html, Html5, Iframe, Javascript, jQuery, Php, Pingback, Wordpress
      Number of Javascript: 14
      Number of meta tags: 3
    3. Doç.Dr. Bahadır Ege – Primum non nocere
      Turkey - 94.73.148.213
      Server software: Apache
      Technology: CSS, Flexslider, Font Awesome, Google Font API, Html, Html5, Javascript, jQuery, Php, Pingback, Shortcodes, SuperFish, Wordpress
      Number of Javascript: 20
      Number of meta tags: 3
    4. jpgenzostudio.com Museum Quality Prints on Canvas – JP Genzo Studio
      jpgenzostudio.com delivers Museum Quality Prints on Canvas of my Original Fine Art and Illustration
      Ottawa (Canada) - 23.227.38.32
      Server software: nginx
      Technology: CSS, Flexslider, Html, Javascript, SVG, Shopify
      Number of Javascript: 6
      Number of meta tags: 3
    5. Knock Em Dead Resume Writing & Career Coaching Services
      Home, Blog & Shop of Martin Yate, NY Times Bestselling Professional Career Coaching, Linkedin & Resume Writing Services Author for over 30 years.
      Scottsdale (United States) - 166.62.54.71
      Server software: Apache/2.2.31 (Unix) mod_ssl/2.2.31 OpenSSL/1.0.1e-fips mod_bwlimited/1.4
      Technology: BootstrapCDN, Maxcdn, CSS, Flexslider, Font Awesome, Html, Html5, Javascript, jQuery UI, Php, Google Analytics, Wordpress, Facebook Box
      Number of Javascript: 19
      Number of meta tags: 15
    6. ROBERTO SOZZI - FINE ART PHOTOGRAPHY
      FINE ART CONTEMPORARY PHOTOGRAPHY
      Arezzo (Italy) - 31.11.33.182
      Server software: Apache
      Technology: CSS, Html, Javascript
      Number of Javascript: 1
      Number of meta tags: 11
    7. Arackal
      With over 12 years of experience delivering to clients all over the world, Arackal helps start-ups or well-established companies effectively navigate today's modern technology landscape with a focus o
      Wayne (United States) - 74.208.165.106
      Server software: squid/3.5.9
      Technology: CSS, Flexslider, Html, Javascript
      Number of Javascript: 2
      Number of meta tags: 6
    8. wesvirginfatdiminishersystem.com
      Ashburn (United States) - 54.243.49.127
      Server software: Apache/2.2.22 (Debian) mod_qos/10.8
      Technology: CSS, Html, Javascript
      Number of Javascript: 1
      Number of meta tags: 3
    9. WAYCO Equipment Ltd
      Wayco Equipment distributes automotive workshop equipment. Brands include Wayco, Rokit Air and KC Tools
      Australia - 202.124.241.203
      Server software: LiteSpeed
      Technology: Html
      Number of Javascript: 2
      Number of meta tags: 5
    10. Tax Sentinel
      San Francisco (United States) - 192.241.207.240
      Server software: Apache/2.4.7 (Ubuntu)
      Technology: BootstrapCDN, Maxcdn, CSS, Flexslider, Font Awesome, Html, Html5, Javascript, jQuery, Lightbox, Php, Pingback, Wordpress
      Number of Javascript: 17
      Number of meta tags: 3

    Check Other Websites